HOME

CONTACT

ORDER

 

 

 

Terms Of Use
AGREEMENT

The following Terms of Use Agreement governs and applies to all the domain names, their sub-domains and sub-directories that relate to and constitute the property of IME – Information Master Extreme. For reference in this Agreement and this Website; the abbreviation IME stands for and is a trademark of Information Master Extreme! If you do not agree to the Terms of Use Agreement, discontinue using this website immediately.

We provide this website to you, subject to the following Terms of Use Agreement, which may be updated by us from time to time without notice to you.

This Terms of Use Agreement sets forth the standards of use of this IME - Information Master Extreme website. By using this website you (the user) agree to these terms and conditions. If you do not agree to the terms and conditions of this agreement, you should immediately cease all usage of this website. IME - Information Master Extreme reserves the right, at any time, to modify, alter, or update the terms and conditions of this agreement without prior notice.  Modifications shall become effective immediately upon being posted at this website.  Your continued use of this website after amendments are posted constitutes an acknowledgement and acceptance of the Terms of Use Agreement and its modifications. Except as provided in this paragraph, this Terms of Use Agreement may not be amended.

You must read, agree with and accept all of the terms and conditions contained in this Terms of Use Agreement and the Privacy Policy, which include those terms and conditions expressly set out below and those incorporated by reference, before you may use our website. By viewing, visiting, using or interacting with this website or with any banner, advertising or popup that appears on it, you are agreeing to all the provisions of this Terms of Use Agreement and its policies and the Privacy Policy of this website.

Copyrighted Materials

This website and its contents are owned and/or licensed by IME - Information Master Extreme. Material contained on this website must be presumed to be proprietary and copyrighted. Visitors have no rights whatsoever to this websites contents. The entire contents of this website are protected by international copyright and trademark laws. The owner of the copyrights and trademarks are IME - Information Master Extreme, its affiliates or other third parties. You may not modify, copy, reproduce, republish, upload, post, transmit or distribute, in any manner, the material on this site, including texts, graphics, code, content and software. Use of website content for any reason is unlawful unless it is done with express contract, rights, or permission of IME - Information Master Extreme.

Trademarks

Publications, products, content or services referenced herein or on this website are the exclusive trademarks or servicemarks of IME - Information Master Extreme and/or other third parties. Other product and company names mentioned in the website may be the trademarks of their respective owners.

Third-Party Sites

Our website may include links to other sites on the Internet that are owned and operated by online merchants and other third parties. You acknowledge that we are not responsible for the availability of, or the content located on or through, any third-party site. The linked sites are for your convenience only and you access them at your own risk. You should contact the site administrator or webmaster for those third-party sites if you have any concerns regarding such links or the content located on such sites. Your use of those third-party sites is subject to the terms of use and privacy policies of each site, and we are not responsible therein. We encourage all viewers of this website to review said privacy policies of third-party sites.

Licensing Restrictions

Users agree to abide by any and all licensing rules or restrictions that have been created by the owners of the works contained within this website.

Minimum Age

This website is available only for individuals who can form legally binding contracts under applicable law. Without limiting the foregoing, this website is not for minors. We do not direct this website to minors. We encourage parents to go online with their kids.

Liability

In no event shall IME - Information Master Extreme be liable for any punitive, special, direct, indirect, incidental, or consequential damages, whether arising under contract, warranty, or tort (including negligence or strict liability) or any other theory of liability. Applicable law may not allow the limitation or exclusion of liability or incidental or consequential damages, so the above limitation or exclusion may not apply to you. Our liability for damages, regardless of the form of the action, shall not exceed the fee paid for the item purchased. We cannot be held responsible for factors beyond our control that may interfere with our ability to provide access to our website. Such factors include, but are not limited to server downtime or network outages beyond our servers. IME - Information Master Extreme does not warrant that the functions contained in the materials, resources or services offered will be uninterrupted or error-free, that defects will be corrected, or that this site is free of viruses or other harmful elements. In no event will IME - Information Master Extreme be liable to any party for any direct, indirect, punitive, special, incidental or other consequential damages arising directly or indirectly from any use of the products or resources contained within the website. All products and resources are provided "as is" and without warranties.

These include (but are not limited to) damages or injury caused by any:

1. use of (or inability to use) the site or products
2. use of (or inability to use) any site to which you hyperlink from our site or products
3. failure of our site or products to perform in the manner you expected or desired
4. error on our site or in our products
5. omission on our site or in our products
6. interruption of availability of our site or products
7. defect on our site or in our products
8. delay in operation or transmission of our site or our products
9. line failure, computer virus or harmful elements

Please note that we are not liable for any damages, including:

Damages intended to compensate someone directly for a loss or injury damages reasonably expected to result from a loss or injury (known in legal terms as "consequential damages").

Other miscellaneous damages and expenses resulting directly from a loss or injury (known in legal terms as "incidental damages.") We are not liable even if we’ve been negligent or if our authorized representative has been advised of the possibility of such damages or both.

Exception: Certain state laws may not allow us to limit or exclude liability for these "incidental" or "consequential" damages. If you live in one of those states, the above limitation obviously would not apply which would mean that you might have the right to recover these types of damages.

However, in any event, our liability to you for all losses, damages, injuries, and claims of any and every kind (whether the damages are claimed under the terms of a contract, or claimed to be caused by negligence or other wrongful conduct, or they’re claimed under any other legal theory) will not be greater than the amount you paid if anything to access our site or purchase price of our products.

Indemnification:

Website user agrees to indemnify and hold IME - Information Master Extreme, its parents, subsidiaries, affiliates, officers and employees, harmless from any claim or demand, including reasonable attorneys fees and costs, made by any third party due to or arising out of website users use of this website, the violation of this Agreement, or infringement by website user, or other user of this website using website users computer, of any intellectual property or any other right of any person or entity.

Modifications and Interruption to Website:

IME - Information Master Extreme reserves the right to modify or discontinue this website with or without notice to users. IME - Information Master Extreme shall not be liable to website users or any third party should IME - Information Master Extreme exercise its right to modify or discontinue this website. All website users acknowledge and accept that IME - Information Master Extreme does not guarantee continuous, uninterrupted or secure access to our website and operation of our website may be interfered with or adversely affected by numerous factors or circumstances outside of our control.

Disclaimer Regarding Accuracy of Vendor Information:

Product specifications and other information have either been provided by the Vendors or collected from publicly available sources. While IME - Information Master Extreme makes every effort to ensure that the information on this website is accurate, we can make no representations or warranties as to the accuracy or reliability of any information provided on this website.

IME - Information Master Extreme makes no warranties or representations whatsoever with regard to any product provided or offered by any Vendor, and you acknowledge that any reliance on representations and warranties provided by any Vendor shall be at your own risk.

Use of Site and/or Service:

You understand that, except for information, products or services clearly identified as being supplied by IME - Information Master Extreme, IME - Information Master Extreme does not operate, control or endorse any information, products or services on the Internet in any way. Except for IME - Information Master Extreme - identified information, products or services, all information, products and services offered through this website or on the Internet generally are offered by third parties that are not affiliated with IME - Information Master Extreme. You also understand that IME - Information Master Extreme cannot and does not guarantee or warrant that files available for downloading through this website will be free of infection or viruses, worms, Trojan horses or other code that manifest contaminating or destructive properties. You are responsible for implementing sufficient procedures and checkpoints to satisfy your particular requirements for accuracy of data input and output, and for maintaining a means external to this website for the reconstruction of any lost data.

You assume total responsibility and risk for your use of the site and the internet. IME - Information Master Extreme provides this website and related information "as is" and does not make any express or implied warranties, representations or endorsements whatsoever (including without limitation warranties of title or no infringement, or the implied warranties of merchantability or fitness for a particular purpose) with regard to the service, any merchandise information or service provided through the service or on the internet generally, and IME - Information Master Extreme shall not be liable for any cost or damage arising either directly or indirectly from any such transaction. It is solely your responsibility to evaluate the accuracy, completeness and usefulness of all opinions, advice, services, merchandise and other information provided through this website or on the internet generally. IME - Information Master Extreme does not warrant that this website will be uninterrupted or error-free or that defects in the service will be corrected.

You understand further that the pure nature of the internet contains unedited materials some of which are sexually explicit or may be offensive to you. Your access to such materials is at your own risk. IME - Information Master Extreme has no control over and accepts no responsibility whatsoever for such materials.

Contents of Site:

IME - Information Master Extreme disclaims any responsibility for the accuracy of the content of this website. Visitors assume all risk of viewing, reading, using, or relying upon this information. Unless you have otherwise formed an express contract to the contrary with IME - Information Master Extreme, you have no right to rely on any information contained herein as accurate. The website makes no such warranty. Visitor downloads information from this site at their own risk. This website makes no warranty that downloads are free of corrupting computer codes, including, but not limited to, viruses and worms.

Use of Information:

Unless you have entered into an express contract with IME - Information Master Extreme to the contrary, visitors, viewers, subscribers, members, affiliates, or customers have no right to use this information in a commercial or public setting; they have no right to broadcast it, copy it, save it, print it, sell it, or publish any portions of the content of this website, unless you are licensed to do so. By viewing the contents of this website you agree to this condition of viewing and you acknowledge that any unauthorized use is unlawful and may subject you to civil or criminal penalties. Again, Visitor has no rights whatsoever to use the content of, or portions thereof, including its databases, invisible pages, linked pages, underlying code, or other intellectual property the site may contain, for any reason for any use whatsoever. Visitor warrants that he or she understands that accepting this provision is a condition of viewing and that viewing constitutes acceptance.

Disputes:

As part of the consideration that the website requires for viewing, using or interacting with this website, visitor agrees to use binding arbitration for any claim, dispute, or controversy ("CLAIM") of any kind (whether in contract, tort or otherwise) arising out of or relating to this purchase, this product, including solicitation issues, privacy issues, and terms of use issues.

You and we agree that any and all disputes arising out of or related to this Agreement shall be decided by binding arbitration pursuant to the Commercial Arbitration Rules of the American Arbitration Association which are in effect on the date a dispute is submitted to the American Arbitration Association.

Information about the American Arbitration Association, its rules, and its forms are available from the American Arbitration Association, 335 Madison Avenue, Floor 10, New York, NY, 10017-4605 or at http://www.adr.org. Hearing will take place in the city or county of the Seller.

In no case shall the viewer, visitor, member, subscriber or customer have the right to go to court or have a jury trial. Viewer, visitor, member, subscriber or customer will not have the right to engage in pre-trial discovery except as provided in the rules; you will not have the right to participate as a representative or member of any class of claimants pertaining to any claim subject to arbitration; the arbitrator's decision will be final and binding with limited rights of appeal.

You represent and agree that you are purchasing our services or products for business purposes, and not for any consumer, personal, or household use, and that you are not deemed to be a 'consumer' and will not invoke arbitration rules applicable to consumers.

The prevailing party shall be reimbursed by the other party for any and all costs associated with the dispute arbitration, including attorney fees, collection fees, investigation fees, travel expenses.

You agree that the arbitrator can enter a default judgment against you if you do not follow AAA rules, and that default judgment can be entered and enforced in any court of competent jurisdiction and in the courts of Pinellas County, in the State of Florida.

Notice:

No additional notice of any kind for any reason is due Visitor and Visitor expressly warrants an understanding that the right to notice is waived as a condition for permission to view or interact with this website.

Third Party Rights:

The provisions of paragraphs "Use of Site and/or Service", and "Indemnification" are for the benefit of IME - Information Master Extreme and its officers, directors, employees, agents, licensors, suppliers, and any third party information providers to this website or service. Each of these individuals or entities shall have the right to assert and enforce those provisions directly against you on its own behalf.

Termination of This Agreement:

These Terms of Use are effective until terminated by either party. You may terminate these Terms of Use by destroying all copies and installations of products and services obtained from us. The agreement will automatically and immediately terminate without notice should you violate any terms of this agreement. Violating our Terms Of Use, Copyrights, or any of our licensing restrictions, will result in termination and forfeiture of all reseller licenses, without notice or refund.

Jurisdiction and Other Points to Consider:

If you use our site from locations outside of the United States, you are responsible for compliance with any applicable local laws. To the extent you have in any manner violated or threatened to violate IME - Information Master Extreme and/or its affiliates' intellectual property rights, IME - Information Master Extreme and/or its affiliates may seek injunctive or other appropriate relief in any state or federal court in the State of Florida, and you consent to exclusive jurisdiction and venue in such courts. If any matter concerning this purchase shall be brought before a court of law, pre- or post-arbitration, Viewer, visitor, member, subscriber or customer agrees to that the sole and proper jurisdiction to be the state and city declared in the contact information of the website owner unless otherwise here specified.

Our failure to enforce any rights granted in this Agreement or to take action against any other party in the event of any breach shall not be deemed a waiver by us as to subsequent enforcement of rights or subsequent actions in the event of future breaches.

Users agree to comply with all applicable domestic and international laws, statutes, ordinances and regulations regarding use of this website.

Users agree to abide by any and all licensing rules or restrictions that have been created by the owners of the works contained within this website. Violating our Terms Of Use, Copyrights, or any of our licensing restrictions, will result in termination of account, and forfeiture of all licenses, without notice or refund. Furthermore, use of this website constitutes acceptance of the Earnings Disclaimer, Privacy Policy and Terms Of Use.

This Agreement in all respects shall be governed by and construed according to the laws of the State of Florida, to the exclusion of any other applicable body of governing law, without regard to conflicts of laws principles.

This Agreement contains the complete and entire understanding and agreement between you and us and supersedes any previous communications, representations, or agreements, verbal or written, related to the subject matter of this Agreement.

This Agreement may not be modified or amended orally, impliedly, or in any manner not set forth in writing or permitted by this Agreement. This Agreement may be amended by us at any time and without notice, but only by amending this Agreement as posted on this website, unless otherwise agreed to in a writing signed by both of us. Any amendments will become effective 30 days after being posted on the website, unless circumstances require that a change be immediately implemented.

You agree that your continued use of our product or service after that date will constitute your consent and acceptance of the amendment.

If any provision of this agreement is void or unenforceable in whole or in part, the remaining provisions of this Agreement shall not be affected thereby.

IME - Information Master Extreme reserves the right to amend this agreement at any time.

This is a web site of IME - Information Master Extreme.

Our postal address is:
IME - Information Master Extreme
9281 Seminole Blvd.
Seminole, FL 33772

Guarantee

termsprivacydisclaimeraffiliatescontact

CLICKBANK® is a registered trademark of Click Sales, Inc. and used by permission. Frank DeJohn is not an authorized agent or representative of Click Sales, Inc. Click Sales, Inc. has not reviewed, approved or endorsed "How To Buy An Established Turnkey Business For Immediate Success", or any claim, statement or opinion made by Frank DeJohn.

Copyright©2010 IME-Information Master Extreme - All Rights Reserved.